DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and NUC1

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_012327.1 Gene:NUC1 / 853222 SGDID:S000003744 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:64/287 - (22%)
Similarity:98/287 - (34%) Gaps:87/287 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PATMYRVGY--NVGNNQFLELYRACFDTRAVRAIFV-EHRVYGKPFYIT----------RPCVQF 154
            |:..::.|:  .:.:.|..|.:.:|::.:.....:| ||        ||          |....|
Yeast    56 PSGFFKYGFPGPIHDLQNREEFISCYNRQTQNPYWVLEH--------ITPESLAARNADRKNSFF 112

  Fly   155 SSDGVISGADEASYTVRNIHGTFRRLFGNNQNYIPNNRDVIINRGHLAASADFFFGDQ-LCATFK 218
            ..|.||.                .:..|..::|..:..|    |||.|.:||..|..| :..||.
Yeast   113 KEDEVIP----------------EKFRGKLRDYFRSGYD----RGHQAPAADAKFSQQAMDDTFY 157

  Fly   219 YVNAVPQF-KSINDGNWETIERFVRNSVTGNNFVNVRTGARGVLSLPSGNRPKNVFLSGNR---N 279
            ..|..||. :..|...|..:|.|.|........|.:.||.   |.||..:...|.|.....   |
Yeast   158 LSNMCPQVGEGFNRDYWAHLEYFCRGLTKKYKSVRIVTGP---LYLPKKDPIDNKFRVNYEVIGN 219

  Fly   280 P----VPQWMYKIV----RNAN--------------NQPIVAFLTLNN----IYARQRPAA---- 314
            |    ||...:|::    ..||              |:||.....|.:    |.|.:|...    
Yeast   220 PPSIAVPTHFFKLIVAEAPTANPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALERSTGLELL 284

  Fly   315 ----PN----FCQPVNCPVALVNTAQA 333
                |:    .|:.|||.:.:.:.:.|
Yeast   285 QKVPPSKKKALCKEVNCQIVVRDFSNA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 64/287 (22%)
NUC1NP_012327.1 NUC1 8..308 CDD:224777 63/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.