DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and zgc:172339

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001104647.1 Gene:zgc:172339 / 564384 ZFINID:ZDB-GENE-080204-115 Length:288 Species:Danio rerio


Alignment Length:196 Identity:49/196 - (25%)
Similarity:71/196 - (36%) Gaps:55/196 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 RVYGKPFYIT----------RPCVQFS-SDG---------------VISGADEASYTVRNIHGTF 177
            |..|||.|:|          .....|. |||               ..|.:.|......|:||: 
Zfish    54 RYNGKPRYVTLYDVVDHIPVYSAYTFKRSDGSKKVDVPWMFEPQLSTTSDSGEMQAFPPNVHGS- 117

  Fly   178 RRLFGNNQNYIPNNRDVI-INRGHLAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIERFV 241
               |.:.|..:.:..::: ..||||.........|...||:...|.|||.:..|.|:|:..|..:
Zfish   118 ---FSDTQAVLEDYSNIVEFERGHLNPDEHQAHPDDKAATYTLTNVVPQVREFNIGHWKRHEHII 179

  Fly   242 RNSVTGNNFVNVRTGARGVLSLPSGNRPKNVFLSG--------NRNPVPQWM---YKIVRNANNQ 295
            |..:  ||:      .||...:.:|     |..||        ||..||.::   |..|...:|.
Zfish   180 RRRL--NNY------CRGTAYIVTG-----VTTSGRMIRRYNINRVAVPTYLWSAYCCVDYDHNA 231

  Fly   296 P 296
            |
Zfish   232 P 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 49/196 (25%)
zgc:172339NP_001104647.1 Endonuclease_NS 58..268 CDD:214889 47/192 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.