DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and CG6839

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_649076.1 Gene:CG6839 / 40067 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster


Alignment Length:334 Identity:82/334 - (24%)
Similarity:147/334 - (44%) Gaps:57/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETLQMWC------NPRDIVATTCQAGRV------------------PAFQP-PLPMTCRAAPAA 92
            |.:||:||      :..:::..:|.:|..                  |.|:. ....||..    
  Fly    94 GGSLQLWCPSGFNTHSENLLTASCVSGTTFSVGGSNFEFKDLYCKSWPGFKAVKSGATCNG---- 154

  Fly    93 ITTPVQDRRCPATMYRVGYNVGNNQFLELYRACFDTRAVRAIFVEHRVY-GKPFYITRPC-VQFS 155
                       ..:.|||:.:.:::|.|..:.||:.......:..|::. |..:|.|... :.|.
  Fly   155 -----------GIVIRVGFEITSSRFAEQMQICFNEEEEVTRYTRHKLEPGSNYYETGVARITFQ 208

  Fly   156 SDGVISGAD-EASYT-VRNIHGTFRRLFGNNQNYIPNNRDVIINRGHLAASADFFFGDQLCATFK 218
            :.|...|.: :..|| ...:......|.|:.:.|..::.:|.:.||||.|.|||.:..:..|||.
  Fly   209 TAGFFDGKNVDKLYTQATQLETINNELGGDAEKYFDSSSNVYLARGHLGAKADFDYAPEQRATFL 273

  Fly   219 YVNAVPQFKSINDGNWETIERFVRNSVTGNNF-VNVRTGARGVLSLPSGN---RPKNVFLSGNRN 279
            ::||.||:::.|.|||..:|..:|..|:.|.. ||..||..||.:||:.:   .|..:....|.|
  Fly   274 FINAAPQWQTFNAGNWARVEDGLRAWVSKNKLNVNCYTGVYGVTTLPNKDGVETPLYLAKDDNNN 338

  Fly   280 ---PVPQWMYKIVRNANNQPIVAFLTLNNIYARQRPAAPNF--CQPVNCPVALVN----TAQAGF 335
               |||:..:::|.:.::...:.|:.:||.:..:.....::  |..|:..|..:|    ..:||:
  Fly   339 GLIPVPKLYFRVVIDPSSHRGIVFVGVNNPHLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGW 403

  Fly   336 SFCCNPATF 344
            |:.|..|.|
  Fly   404 SYACEVADF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 70/258 (27%)
CG6839NP_649076.1 NUC 170..420 CDD:238043 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.