DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and EndoG

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster


Alignment Length:266 Identity:63/266 - (23%)
Similarity:94/266 - (35%) Gaps:67/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PPLPMTCRAAPAAITTPVQDRR--CPATMYRVGYNVGNNQFLEL-------------YRACFDTR 129
            |.|| |.....||...|.|:..  ..||..|:|      |.::.             |...:|.|
  Fly    43 PGLP-TFGTVSAASLIPAQENNVSLTATPSRIG------QIMKYGFPGLDHVRSHSDYVLSYDRR 100

  Fly   130 AVRAIFVEHRVY--------GKPFYITRPCVQFSSDGVISGADEASYTVRNIHGTFRRLFGNNQN 186
            .    .|.|.|:        .|...:.|....|..|             .:||..||   ..|.:
  Fly   101 N----RVPHWVFEHLTAESVAKNDAVDRSKCDFKQD-------------ESIHPFFR---SQNTD 145

  Fly   187 YIPNNRDVIINRGHLAASADFFFGDQLC-ATFKYVNAVPQF-KSINDGNWETIERFVRNSVTGNN 249
            |..:..|    |||:||:.:.....:.| .||...|..||. :..|...|.|:|..||......:
  Fly   146 YRRSGYD----RGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKTYS 206

  Fly   250 FVNVRTGARGVLSLP-----SGNRPKNVFLSGNRNPVPQWMYKIV--RNANNQ-PIVAFLTLNNI 306
            .|.|.||.   |.||     ..:..|...:..|...||...||::  .:|::: .:.:::..|.:
  Fly   207 NVYVCTGP---LYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVIVGESADHKLHMESYVMPNQV 268

  Fly   307 YARQRP 312
            .:...|
  Fly   269 ISNDTP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 55/242 (23%)
EndoGNP_610737.1 NUC1 39..305 CDD:224777 63/266 (24%)
NUC 77..309 CDD:238043 50/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.