DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and Endog

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog / 362100 RGDID:1310763 Length:294 Species:Rattus norvegicus


Alignment Length:229 Identity:57/229 - (24%)
Similarity:85/229 - (37%) Gaps:45/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GRVP------AFQPPLPMTCRAAPAAITTPVQDRRCPATMYRVGYNVGNNQFLELYRACFDTRAV 131
            ||||      |..|.||    ..||..|..:.....|        .|...:..|.|...:|.|..
  Rat    35 GRVPVLPVVAADLPALP----GGPAGSTGELAKYGLP--------GVAQLRSRESYVLSYDPRTR 87

  Fly   132 RAIFVEHRVYGKPFYITRPCVQFSSDGVISGADEASYTVRNIHGTFRRLFGNNQNYIPNNRDVII 196
            .|::|..::        || .:...||.....|  .:...::|...|   ..|.:|    |....
  Rat    88 GALWVLEQL--------RP-ERLRGDGDRRACD--FHEDDSVHAYHR---ATNADY----RGSGF 134

  Fly   197 NRGHLAASADFFFGDQ-LCATFKYVNAVPQFKSINDGNWETIERFVRNSVTGNNFVNVRTGARGV 260
            :||||||:|:..:..: :..||...|..||...:|...|..:|::.|:.......|.|.||.   
  Rat   135 DRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQHAWNNLEKYSRSLTRTYQNVYVCTGP--- 196

  Fly   261 LSLP-----SGNRPKNVFLSGNRNPVPQWMYKIV 289
            |.||     ..:..|...:..|...||...:|::
  Rat   197 LFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 46/194 (24%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 44/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.