DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and Tengl2

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster


Alignment Length:173 Identity:42/173 - (24%)
Similarity:63/173 - (36%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IPNN--------RDVIINRGHLAASADFFFGDQLCA-TFKYVNAVPQF-KSINDGNWETIERFVR 242
            :|:|        |....:||||||:.:.......|. ||...|..||. :..|...|..:|::||
  Fly   133 VPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVR 197

  Fly   243 NSV--TGNNFV--------NVRTGARGVLSLPSGNRPKNVFLSGNRNPVPQWMYKIVRNANNQPI 297
            |.|  .|:.||        |.|.|.:..:...        .:..|...||...:|::.      :
  Fly   198 NLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYE--------MIGLNMVAVPTHFFKVIM------V 248

  Fly   298 VAFLTLNNIYARQRPAAPNFCQPVNCPVALVNTAQAGFSFCCN 340
            .:.|.|...| .:....||...|...|:.         ||.|:
  Fly   249 ESKLHLGKPY-MEGYVLPNAPIPDGLPLR---------SFLCD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 42/173 (24%)
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.