DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and Exog

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_006244150.2 Gene:Exog / 301062 RGDID:1304628 Length:443 Species:Rattus norvegicus


Alignment Length:340 Identity:77/340 - (22%)
Similarity:122/340 - (35%) Gaps:76/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RFTRAQVQGTNRIFMVRGQNRQLSLKRTASSAVGETLQMWCNPRDIVATTCQAGRVPAFQPPLPM 84
            |..|.:::|.:::  :..||......|.||..:.|..: |     ::...|...|          
  Rat    46 RSPRVRMRGRDKV--LAAQNHGCKGLRFASQGLAEVSE-W-----LLGRGCSGRR---------- 92

  Fly    85 TCRAAPAAITTPVQDR----------RC---PATMYRVGYNVGNNQFLELYRACFDTRAVRAIFV 136
            ..||..||: .|...|          ||   |.|  .:.:.......||.:.........|. :.
  Rat    93 RSRADGAAV-PPASGRGVREAGEAAARCSTVPGT--ELAFKSVEKVVLEQFGFPLTGTETRR-YT 153

  Fly   137 EHRV-YGKPFYITRPCVQ-FSSDGVISGADEASYTVR---NIHGTFRRLFGNNQNYIPNNRDVII 196
            .|.: |.:...:.|..:: .|.|.:|..||......:   .:...|..|   |::||.:.    .
  Rat   154 NHALSYDQAKRVPRWVLEHISKDKIIGDADRKHCKFKPDPTVPSAFSAL---NEDYIGSG----W 211

  Fly   197 NRGHLA-ASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIERFVRNSVTGNNFVNVRTGARGV 260
            :|||:| |..:.|..:.:..||...|.|||....|.|.|..||.:.|...  ..|.:|.. ..|.
  Rat   212 SRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFENNSGYWNRIEMYCRELT--ERFEDVWI-VSGP 273

  Fly   261 LSLP----SGNRPKNVFLSGNRN-PVPQWMYKIVRNANNQPIVAFLTLNNIYARQRPAAPNFCQP 320
            |:||    .|.:..:..:.|..| .||..:||:                 |.||:   :|...:|
  Rat   274 LTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKV-----------------ILARR---SPESTEP 318

  Fly   321 VNCPVALVNTAQAGF 335
            :.....:|.....||
  Rat   319 LALGAFVVPNKAIGF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 58/248 (23%)
ExogXP_006244150.2 NUC 152..361 CDD:214683 52/212 (25%)
Exog_C 377..425 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.