DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and si:dkey-243k1.3

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001373225.1 Gene:si:dkey-243k1.3 / 100537487 ZFINID:ZDB-GENE-131121-191 Length:283 Species:Danio rerio


Alignment Length:325 Identity:71/325 - (21%)
Similarity:103/325 - (31%) Gaps:119/325 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSAVGETL-QMWCNPRDIVATTCQAGRVP---AFQPPLPMTCRAAPAAITTPVQDRRCPATMYRV 109
            |.|.|..| ..|.:| |.|....:. ::|   ||||.|...|:                      
Zfish    16 SPADGHVLDHFWDSP-DCVKFFYKE-KIPDLGAFQPNLVRICQ---------------------- 56

  Fly   110 GYNVGNNQFLELYR--ACFDTRAVRAIFVEHRVYGKPFYITRPCVQFSSDGVISGADEASYTVRN 172
                   :||..|.  ..:||        .||:.....||..|    ||.|              
Zfish    57 -------RFLNTYHFATLYDT--------YHRIAVYSAYIFEP----SSGG-------------- 88

  Fly   173 IHGTFRRLFGNNQNYIP--------------NNRDVII---------------NRGHLAASADFF 208
              |..:|.|...|...|              .|.|:.:               :||||..:....
Zfish    89 --GREKRWFVEPQLVSPAWSTEMEDGYKLSQQNPDIYLGEKQALNEDYTNSGFDRGHLNPNGHHA 151

  Fly   209 FGDQLCATFKYVNAVPQFKSINDGNWETIERFVRNSVTGN-NFVNVRTGARGVLSLPSGNRPKNV 272
            ...: .|||...|.|||..::|...|...|..:.:....| :...|..||     :||.|   |.
Zfish   152 VPSR-NATFTLTNVVPQNPTLNQNAWNKHESKLTSLFKANCHQAYVLVGA-----IPSSN---NW 207

  Fly   273 FLSGN--RNPVPQWMYK--IVRNANNQPIVAFLT------LNNIYARQRPAAPNFCQ-----PVN 322
            .:..|  |..:|::::.  ...:.|.:||::...      ||.:..|......:|.|     |||
Zfish   208 IIKNNVKRVNIPEYLWDAFCCIDQNGRPILSGAATALNTELNVVVERSLDEMVDFIQQFSDAPVN 272

  Fly   323  322
            Zfish   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 56/268 (21%)
si:dkey-243k1.3NP_001373225.1 Endonuclease_NS 62..263 CDD:214889 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.