DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and LOC100487990

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_002932825.1 Gene:LOC100487990 / 100487990 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:114 Identity:38/114 - (33%)
Similarity:49/114 - (42%) Gaps:15/114 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 NRGHLAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIERFVRNSVTGNNFVNVRTGARGVL 261
            :||||.........|...|||...||||...|:|.|.|...|:.:.......|.:.|.||.    
 Frog   171 HRGHLNPVCHHEDKDAQDATFTLTNAVPMDSSLNQGQWRIYEKQMIAKARDCNTMYVVTGI---- 231

  Fly   262 SLPSGNRPKNVFLSGNRNPVPQ--W-MYKIVRNANNQPIVAFLTL-NNI 306
             :|..|..||     :|..:|.  | .|..|.| |::||.:...| |||
 Frog   232 -VPGNNWIKN-----DRVNIPSQVWSAYCCVGN-NDKPIGSGAGLANNI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 38/114 (33%)
LOC100487990XP_002932825.1 Endonuclease_NS 79..294 CDD:214889 38/114 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.