DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and exog

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_031760009.1 Gene:exog / 100486077 XenbaseID:XB-GENE-981839 Length:353 Species:Xenopus tropicalis


Alignment Length:274 Identity:60/274 - (21%)
Similarity:98/274 - (35%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ATTCQAG------RVPAFQPPLPMTCRAAPAAITTPVQDRRCPATMYRVGYNVGNNQFLELYRAC 125
            :.:|.|.      |.|...|..|:.        ..|:::...|.|.|...:              
 Frog    21 SASCLAALQLYERREPQLAPVAPVQ--------KDPLEEYGFPLTGYEARH-------------- 63

  Fly   126 FDTRAVRAIFVEHRVYGKPFYITRPCV--QFSSDGVISGADEASYTVRNIHGTFR------RLF- 181
                     ::.|.:...|...|...|  ..|...::..||..       |..|:      ::| 
 Frog    64 ---------YINHALSYDPAKRTPKWVIEHLSGTKIVGSADRK-------HCKFKPDPNIPKMFS 112

  Fly   182 GNNQNYIPNNRDVIINRGHLAASADFFFGDQLCA-TFKYVNAVPQFKSINDGNWETIERFVRNSV 245
            ..|::|:.:.    ..|||:|.:.|..|..:..| ||...|.|||....|.|.|..:|.:.|:..
 Frog   113 ATNEDYLRSG----WTRGHMAPAGDNKFSTEAMAETFYLSNIVPQNYENNAGFWNRMEMYCRDLT 173

  Fly   246 TGNNFVNVRTGARGVLSLPS--GNRPKNVF---LSGNRNPVPQWMYKIV---RNANNQPIV--AF 300
              ..|.:|.. ..|.|.||:  .:..|.|.   :..:...||..:||::   ...:.||:.  ||
 Frog   174 --KRFEDVWV-VSGPLELPTLHEDGKKRVMYEVIGADDVSVPSHLYKVILVRGKGSEQPLAVGAF 235

  Fly   301 LTLNNI--YARQRP 312
            :..|:.  :.||.|
 Frog   236 VVPNSPIGFDRQLP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 53/233 (23%)
exogXP_031760009.1 NUC 66..273 CDD:214683 50/198 (25%)
Exog_C 292..336 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.