DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and LOC100333474

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_017210192.1 Gene:LOC100333474 / 100333474 -ID:- Length:471 Species:Danio rerio


Alignment Length:113 Identity:27/113 - (23%)
Similarity:44/113 - (38%) Gaps:44/113 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 INRGHLAASADFFFGDQLC-ATFKYV----NAVPQFKSINDGNWETIERFVRNSVT-----GNNF 250
            :.|||||.:|:    .:.| ..::.|    |..||..::|:|.|:.:|   .|..|     .||.
Zfish   281 MTRGHLATAAN----HRWCREAYQDVNIDNNMAPQHLALNNGIWKALE---NNCQTIFEDENNNI 338

  Fly   251 --VNVRTGARGVLSLPSGNRPKNVFLSGNRNPVPQWMYKIVRNANNQP 296
              |:|.||                         |.:.||..:.::.:|
Zfish   339 RNVHVYTG-------------------------PLYNYKETKKSSEKP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 27/113 (24%)
LOC100333474XP_017210192.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.