DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and si:dkey-85k7.10

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_021333817.1 Gene:si:dkey-85k7.10 / 100004057 ZFINID:ZDB-GENE-160728-49 Length:299 Species:Danio rerio


Alignment Length:115 Identity:32/115 - (27%)
Similarity:51/115 - (44%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 FGNNQNYIPNNRDVI-INRGHLAASADFFFGDQL--CATFKYVNAVPQFKSINDGNWETIERFVR 242
            |.:.|..:.:..||: ..||.|  :.|....|.|  .||:...|.||..:..:.|.|.|....:|
Zfish   129 FEDTQAVLEDYADVVQYERGQL--NPDEHQADPLDKAATYTLTNVVPLIREFSFGPWSTQVEVIR 191

  Fly   243 NSVTGNNF----VNVRTGARGVLSLPSGN--RPKNVFLSGNRNPVPQWMY 286
            ..:  ||:    .:|.||.     ..|||  |.:|:    :|..:|::|:
Zfish   192 KRL--NNYCHGKAHVITGV-----TTSGNMIRRENL----DRVAIPEFMW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 32/115 (28%)
si:dkey-85k7.10XP_021333817.1 Endonuclease_NS 66..276 CDD:214889 32/115 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.