DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and LOC100002544

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_001920405.3 Gene:LOC100002544 / 100002544 -ID:- Length:336 Species:Danio rerio


Alignment Length:206 Identity:46/206 - (22%)
Similarity:70/206 - (33%) Gaps:59/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 GTFRRLFGNNQNYIPNNRDVII-NRGHLAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIE 238
            |.....|.::|..:.:..||:: .||||.............||:...|.||:.:..|.|.|...|
Zfish   150 GYLHMKFEDSQAVLDDYSDVVLYERGHLNPDQHQSDPQDRAATYTLTNVVPEIREFNIGPWRQYE 214

  Fly   239 RFVRNSVTGNNFVN----VRTGARGVLSLPSGN--RPKNVFLSGNRNPVPQWMYK---------- 287
            ..:|  |..|||..    :.||.     :.:||  |..|:    ||..:|:.::.          
Zfish   215 ERIR--VRLNNFCRGTAYIVTGV-----IHAGNMIRRNNL----NRVGIPEDVWSAYCCTDYDRN 268

  Fly   288 --------------IVRNANNQPIVAFLT---LNNIYARQRPAAPNFCQPVNCPVALVNTAQAGF 335
                          |.:||.....|..||   |..|..::.....||              |..:
Zfish   269 SPHVERIHFPTYAAIAKNAKEGNTVQELTVLELELILTQRMNVDMNF--------------QLFY 319

  Fly   336 SFCCNPATFRP 346
            ..|.:|:...|
Zfish   320 DNCNSPSPLPP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 45/202 (22%)
LOC100002544XP_001920405.3 Endonuclease_NS 95..>273 CDD:214889 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.