Sequence 1: | NP_001034074.1 | Gene: | CG14062 / 43389 | FlyBaseID: | FBgn0039592 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001920405.3 | Gene: | LOC100002544 / 100002544 | -ID: | - | Length: | 336 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 46/206 - (22%) |
---|---|---|---|
Similarity: | 70/206 - (33%) | Gaps: | 59/206 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 GTFRRLFGNNQNYIPNNRDVII-NRGHLAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIE 238
Fly 239 RFVRNSVTGNNFVN----VRTGARGVLSLPSGN--RPKNVFLSGNRNPVPQWMYK---------- 287
Fly 288 --------------IVRNANNQPIVAFLT---LNNIYARQRPAAPNFCQPVNCPVALVNTAQAGF 335
Fly 336 SFCCNPATFRP 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14062 | NP_001034074.1 | Endonuclease_NS | 102..344 | CDD:279553 | 45/202 (22%) |
LOC100002544 | XP_001920405.3 | Endonuclease_NS | 95..>273 | CDD:214889 | 32/133 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 40 | 1.000 | Domainoid score | I12511 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D556753at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |