DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10011 and AT5G60070

DIOPT Version :9

Sequence 1:NP_651624.2 Gene:CG10011 / 43387 FlyBaseID:FBgn0039590 Length:2119 Species:Drosophila melanogaster
Sequence 2:NP_200815.1 Gene:AT5G60070 / 836129 AraportID:AT5G60070 Length:548 Species:Arabidopsis thaliana


Alignment Length:348 Identity:87/348 - (25%)
Similarity:155/348 - (44%) Gaps:56/348 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1487 TPLWAACTAGHATVVKLLL---FWGCGIDCMDSEGRTVLSIGAAQGNVETVRQLLDRGLDETHRD 1548
            ||   |..|...||||..:   |.|      ..|...:|| ...:|:...|:::|...::...  
plant     8 TP---APMAAKPTVVKKTMAKQFTG------KREDSQLLS-AVRRGDFSAVKEILSNHMESED-- 60

  Fly  1549 NAGWTPLHYAAFEGFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALL---DIHSSF 1610
                                :|.:...|.::|   |:|||::||:.|....|..|:   |:..: 
plant    61 --------------------ELRDLLRKQNQC---GETALYVAAEYGDADVVAELIKYYDLEDA- 101

  Fly  1611 VDQKAHDGKTAFRLACLEGHMDTVEFLLKFCCDVN-SKDADSRTTLYILALENKLEIVKYLLDMT 1674
             :.||.:|...|.:|..:|.:|.:..|::...::: :.|..:.|.|:..|.:..:|:|:|||:..
plant   102 -ETKARNGFDPFHIAAKQGELDVLRVLMEEHPELSMTVDLSNTTALHTAAAQGHVEVVEYLLEAA 165

  Fly  1675 NVDV-NIPDSEGRTALHVAAWQGHADMVKTLIEAGAD-VNSMDLEARTPLHSCAWQGNHD-VMNI 1736
            ...: .|..|.|:||||.||..|||::||.::....| ....|.:.:||||......:.| |:.:
plant   166 GSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDTATRTDKKGQTPLHMAVKGQSIDVVVEL 230

  Fly  1737 LLYYGALADHACKQGATALGISAQEGHEKCVIALL---QFGANPYKSDHCGRTPIKLAAKSSRTS 1798
            :..:.:..:.|..:|.|||.::.::|..|.|..||   :...:....:..|.||:..|.|:....
plant   231 MKGHRSSLNMADSKGNTALHVATRKGRIKIVELLLDNNETSPSTKAINRAGETPLDTAEKTGHPQ 295

  Fly  1799 ILKIFE------SYTKNEASNPN 1815
            |..:.:      :...|..:.||
plant   296 IAAVLKTRGVPSAKAINNTTRPN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10011NP_651624.2 AAA 344..457 CDD:214640
Methylase_S <772..885 CDD:279728
Ank_4 1237..1291 CDD:290365
ANK 1266..1403 CDD:238125
ANK repeat 1270..1313 CDD:293786
Ank_2 1275..1380 CDD:289560
ANK repeat 1315..1347 CDD:293786
ANK repeat 1349..1380 CDD:293786
Ank_2 1354..1449 CDD:289560
ANK repeat 1382..1413 CDD:293786
ANK 1410..1538 CDD:238125 15/53 (28%)
ANK repeat 1415..1446 CDD:293786
Ank_5 1438..1489 CDD:290568 1/1 (100%)
ANK 1479..1604 CDD:238125 27/119 (23%)
ANK repeat 1484..1515 CDD:293786 10/30 (33%)
Ank_2 1489..1581 CDD:289560 16/94 (17%)
ANK repeat 1517..1548 CDD:293786 6/30 (20%)
ANK repeat 1550..1581 CDD:293786 2/30 (7%)
Ank_2 1555..1648 CDD:289560 21/96 (22%)
ANK 1578..1705 CDD:238125 42/131 (32%)
ANK repeat 1617..1648 CDD:293786 6/31 (19%)
Ank_2 1624..1715 CDD:289560 28/93 (30%)
ANK 1645..1771 CDD:238125 39/129 (30%)
ANK repeat 1650..1682 CDD:293786 9/32 (28%)
ANK repeat 1684..1715 CDD:293786 13/31 (42%)
Ank_2 1689..1781 CDD:289560 27/96 (28%)
ANK repeat 1717..1742 CDD:293786 6/25 (24%)
ANK repeat 1750..1775 CDD:293786 9/27 (33%)
AT5G60070NP_200815.1 Ank_2 36..137 CDD:403870 26/128 (20%)
ANK repeat 36..70 CDD:293786 7/56 (13%)
ANK repeat 73..105 CDD:293786 10/33 (30%)
ANK repeat 107..139 CDD:293786 6/31 (19%)
ANKYR 111..313 CDD:223738 52/201 (26%)
Ank_2 112..202 CDD:403870 28/89 (31%)
ANK repeat 141..174 CDD:293786 9/32 (28%)
ANK repeat 176..208 CDD:293786 13/31 (42%)
ANK repeat 210..242 CDD:293786 6/31 (19%)
PGG 361..477 CDD:404788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8400
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.