DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10011 and AT4G32250

DIOPT Version :9

Sequence 1:NP_651624.2 Gene:CG10011 / 43387 FlyBaseID:FBgn0039590 Length:2119 Species:Drosophila melanogaster
Sequence 2:NP_001031769.1 Gene:AT4G32250 / 829358 AraportID:AT4G32250 Length:611 Species:Arabidopsis thaliana


Alignment Length:514 Identity:97/514 - (18%)
Similarity:147/514 - (28%) Gaps:204/514 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly  1230 IELH-KGKALIHILANDGNHQLLERALNACKSPIDLEIEDYNGQTALNIAARNGHLEVVKLLLSF 1293
            :||| ||..::::                  .|.:..:.|       |..|..|.:.:..||||.
plant   157 LELHSKGFLILNL------------------KPSNFLLSD-------NDKAILGDVGIPYLLLSI 196

  Fly  1294 SQPCNDGTGRMKRVDVNHADRDGWTP-------LRSASWGGHSEVVRLLI-AQPACKIDLADKEG 1350
            ..|.:|.|.|:.  ..|:...:.|.|       ..:.|||....:|.:|. .||           
plant   197 PLPSSDMTERLG--TPNYMAPEQWQPDVRGPMSFETDSWGFGCSIVEMLTGVQP----------- 248

  Fly  1351 RTALRAAAWSGH--EDILKLLI--ESGADVNSVDRQGRTSLIAASYMGHYDI------VEILLEN 1405
                    |||.  ::|..|::  :....:.|.......:|:...:|  ||:      .:|||..
plant   249 --------WSGRSADEIYDLVVRKQEKLSIPSSIPPPLENLLRGCFM--YDLRSRPSMTDILLVL 303

  Fly  1406 GANVNHLD------LDGRSALCVAALCG------SSGYSKVISTLLDH----------------- 1441
            .:..|..:      :|.|.....:|..|      |..:.:|..|:...                 
plant   304 KSLQNSEEEQVRRGIDSREIRKSSATLGYTEWFLSKDHLQVRDTVRSRKPANSCKHENMDVPEGM 368

  Fly  1442 --GANTDQLDNDGM---------SPLLVSSFEGNAEVCELLLENAADPD---------------- 1479
              |...|..|.||.         .||.|     :..|.|.:....|..|                
plant   369 VVGLERDSTDPDGFVLVKVHGVHDPLRV-----HVSVLERVTNGLASGDWVRLKVRKDKRHSPVG 428

  Fly  1480 -----------LADFMGRTPLWAACTAG---------------HATVVKLLLFW---GCGI---- 1511
                       ...|:|...||...::.               .|.||.....|   |.||    
plant   429 VLHSIDREGNVAVGFIGLPTLWKGTSSQLQMAKVYSVGQFVKLKANVVIPRFKWMRKGRGIWATG 493

  Fly  1512 --------DCMDSEGRTVLSIGAAQGN-------VETVRQLLDRGLDETHRDNAGWTPLHYAAFE 1561
                    .|::.:...:|..|...|:       ||.|.....:|..|           .|...|
plant   494 RISQVLPNGCLEVDFPGMLPFGEEHGSYLADPAEVEIVNFNTCQGAVE-----------KYQHLE 547

  Fly  1562 GFHEVCLQLLESGAKIDECDNEGKTALHLAAQEGRLHCVQALLDIHSSFVDQKAHDGKT 1620
            .||.....||.:...:        ||:.|..      ||:..:   ....|.|..||.|
plant   548 DFHWAVRPLLIAMGLL--------TAMKLGI------CVRKKI---GRSKDGKQRDGST 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10011NP_651624.2 AAA 344..457 CDD:214640
Methylase_S <772..885 CDD:279728
Ank_4 1237..1291 CDD:290365 6/53 (11%)
ANK 1266..1403 CDD:238125 33/154 (21%)
ANK repeat 1270..1313 CDD:293786 12/42 (29%)
Ank_2 1275..1380 CDD:289560 27/116 (23%)
ANK repeat 1315..1347 CDD:293786 9/39 (23%)
ANK repeat 1349..1380 CDD:293786 6/34 (18%)
Ank_2 1354..1449 CDD:289560 23/135 (17%)
ANK repeat 1382..1413 CDD:293786 8/36 (22%)
ANK 1410..1538 CDD:238125 38/231 (16%)
ANK repeat 1415..1446 CDD:293786 8/55 (15%)
Ank_5 1438..1489 CDD:290568 14/105 (13%)
ANK 1479..1604 CDD:238125 32/188 (17%)
ANK repeat 1484..1515 CDD:293786 11/60 (18%)
Ank_2 1489..1581 CDD:289560 24/128 (19%)
ANK repeat 1517..1548 CDD:293786 8/37 (22%)
ANK repeat 1550..1581 CDD:293786 6/30 (20%)
Ank_2 1555..1648 CDD:289560 16/66 (24%)
ANK 1578..1705 CDD:238125 10/43 (23%)
ANK repeat 1617..1648 CDD:293786 3/4 (75%)
Ank_2 1624..1715 CDD:289560
ANK 1645..1771 CDD:238125
ANK repeat 1650..1682 CDD:293786
ANK repeat 1684..1715 CDD:293786
Ank_2 1689..1781 CDD:289560
ANK repeat 1717..1742 CDD:293786
ANK repeat 1750..1775 CDD:293786
AT4G32250NP_001031769.1 STKc_PknB_like 40..305 CDD:270916 41/195 (21%)
SH3_15 463..528 CDD:375773 11/64 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2422
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.