Sequence 1: | NP_651624.2 | Gene: | CG10011 / 43387 | FlyBaseID: | FBgn0039590 | Length: | 2119 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_178442.2 | Gene: | AT2G03430 / 814872 | AraportID: | AT2G03430 | Length: | 240 | Species: | Arabidopsis thaliana |
Alignment Length: | 227 | Identity: | 80/227 - (35%) |
---|---|---|---|
Similarity: | 118/227 - (51%) | Gaps: | 20/227 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1321 RSASWGGHSEVVRLLIAQPACKIDLADKEGRTALRAAAWSGHEDILKLLIESGAD-----VNSVD 1380
Fly 1381 RQGRTSLIAASYMGHYDIVEILLENGANVNHLDLDGRSALCVAALCGSSGYSKVISTLLDHGANT 1445
Fly 1446 DQLDNDGMSPLLVSSFEGNAEVCELLLENAADPDLADFMGRTPLWAACTAGHATVVKLLLFWGCG 1510
Fly 1511 IDCMDSEGRTVLS----------IGAAQGNVE 1532 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10011 | NP_651624.2 | AAA | 344..457 | CDD:214640 | |
Methylase_S | <772..885 | CDD:279728 | |||
Ank_4 | 1237..1291 | CDD:290365 | |||
ANK | 1266..1403 | CDD:238125 | 28/86 (33%) | ||
ANK repeat | 1270..1313 | CDD:293786 | |||
Ank_2 | 1275..1380 | CDD:289560 | 21/63 (33%) | ||
ANK repeat | 1315..1347 | CDD:293786 | 6/25 (24%) | ||
ANK repeat | 1349..1380 | CDD:293786 | 15/35 (43%) | ||
Ank_2 | 1354..1449 | CDD:289560 | 39/99 (39%) | ||
ANK repeat | 1382..1413 | CDD:293786 | 12/30 (40%) | ||
ANK | 1410..1538 | CDD:238125 | 47/133 (35%) | ||
ANK repeat | 1415..1446 | CDD:293786 | 13/30 (43%) | ||
Ank_5 | 1438..1489 | CDD:290568 | 22/50 (44%) | ||
ANK | 1479..1604 | CDD:238125 | 21/64 (33%) | ||
ANK repeat | 1484..1515 | CDD:293786 | 9/30 (30%) | ||
Ank_2 | 1489..1581 | CDD:289560 | 16/54 (30%) | ||
ANK repeat | 1517..1548 | CDD:293786 | 9/26 (35%) | ||
ANK repeat | 1550..1581 | CDD:293786 | |||
Ank_2 | 1555..1648 | CDD:289560 | |||
ANK | 1578..1705 | CDD:238125 | |||
ANK repeat | 1617..1648 | CDD:293786 | |||
Ank_2 | 1624..1715 | CDD:289560 | |||
ANK | 1645..1771 | CDD:238125 | |||
ANK repeat | 1650..1682 | CDD:293786 | |||
ANK repeat | 1684..1715 | CDD:293786 | |||
Ank_2 | 1689..1781 | CDD:289560 | |||
ANK repeat | 1717..1742 | CDD:293786 | |||
ANK repeat | 1750..1775 | CDD:293786 | |||
AT2G03430 | NP_178442.2 | ANKYR | 13..210 | CDD:223738 | 69/196 (35%) |
ANK repeat | 46..80 | CDD:293786 | 15/35 (43%) | ||
ANK repeat | 82..113 | CDD:293786 | 12/30 (40%) | ||
Ank_2 | 87..179 | CDD:403870 | 37/94 (39%) | ||
ANK repeat | 115..146 | CDD:293786 | 13/33 (39%) | ||
ANK repeat | 148..179 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 181..212 | CDD:293786 | 9/30 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm2871 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_100012 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |