| Sequence 1: | NP_651624.2 | Gene: | CG10011 / 43387 | FlyBaseID: | FBgn0039590 | Length: | 2119 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001155907.3 | Gene: | ANKRD66 / 100287718 | HGNCID: | 44669 | Length: | 196 | Species: | Homo sapiens |
| Alignment Length: | 123 | Identity: | 41/123 - (33%) |
|---|---|---|---|
| Similarity: | 64/123 - (52%) | Gaps: | 4/123 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1520 TVLSIGAAQGNVETVRQLLDRGLDETHRDNAGW---TPLHYAAFEGFHEVCLQLLESGAKIDECD 1581
Fly 1582 NEGKTALHLAAQEGRLHCVQALLDIHSSFVDQKAHDGKTAFRLACLEGHMDTVEFLLK 1639 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10011 | NP_651624.2 | ANKYR | 1236..1489 | CDD:440430 | |
| ANK repeat | 1270..1313 | CDD:293786 | |||
| ANK repeat | 1315..1347 | CDD:293786 | |||
| ANK repeat | 1349..1380 | CDD:293786 | |||
| ANK repeat | 1382..1413 | CDD:293786 | |||
| ANK repeat | 1415..1446 | CDD:293786 | |||
| ANKYR | 1469..1788 | CDD:440430 | 41/123 (33%) | ||
| ANK repeat | 1484..1515 | CDD:293786 | |||
| ANK repeat | 1517..1548 | CDD:293786 | 8/27 (30%) | ||
| ANK repeat | 1550..1581 | CDD:293786 | 14/33 (42%) | ||
| ANK repeat | 1617..1648 | CDD:293786 | 9/23 (39%) | ||
| ANK repeat | 1650..1682 | CDD:293786 | |||
| ANK repeat | 1684..1715 | CDD:293786 | |||
| ANK repeat | 1717..1742 | CDD:293786 | |||
| ANK repeat | 1750..1775 | CDD:293786 | |||
| ANKRD66 | NP_001155907.3 | ANKYR | <6..>132 | CDD:440430 | 41/123 (33%) |
| ANK 1 | 7..37 | 8/26 (31%) | |||
| ANK repeat | 10..39 | CDD:293786 | 8/28 (29%) | ||
| ANK repeat | 43..74 | CDD:293786 | 13/30 (43%) | ||
| ANK 2 | 43..72 | 13/28 (46%) | |||
| ANK repeat | 76..107 | CDD:293786 | 10/31 (32%) | ||
| ANK 3 | 76..105 | 9/29 (31%) | |||
| ANK repeat | 109..138 | CDD:293786 | 9/23 (39%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 152..196 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||