DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10011 and ANKRD66

DIOPT Version :10

Sequence 1:NP_651624.2 Gene:CG10011 / 43387 FlyBaseID:FBgn0039590 Length:2119 Species:Drosophila melanogaster
Sequence 2:NP_001155907.3 Gene:ANKRD66 / 100287718 HGNCID:44669 Length:196 Species:Homo sapiens


Alignment Length:123 Identity:41/123 - (33%)
Similarity:64/123 - (52%) Gaps:4/123 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1520 TVLSIGAAQGNVETVRQLLDRGLDETHRDNAGW---TPLHYAAFEGFHEVCLQLLESGAKIDECD 1581
            |.|....|.|:...|:::|.:||.:.:..:..|   ||||:||.:|..||...|:|.||:.....
Human    10 TKLHQAVAAGDYSLVKKILKKGLCDPNYKDVDWNDRTPLHWAAIKGQMEVIRLLIEYGARPCLVT 74

  Fly  1582 NEGKTALHLAAQEGRLHCVQALLDIHSSFVDQKAHDGKTAFRLACLEGHMDTVEFLLK 1639
            :.|.|..|.||:.|.|:.::.|..:|:: :|.....|.|..|:|.:.|....|.||.|
Human    75 SVGWTPAHFAAEAGHLNILKTLHALHAA-IDAPDFFGDTPKRIAQIYGQKACVAFLEK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10011NP_651624.2 ANKYR 1236..1489 CDD:440430
ANK repeat 1270..1313 CDD:293786
ANK repeat 1315..1347 CDD:293786
ANK repeat 1349..1380 CDD:293786
ANK repeat 1382..1413 CDD:293786
ANK repeat 1415..1446 CDD:293786
ANKYR 1469..1788 CDD:440430 41/123 (33%)
ANK repeat 1484..1515 CDD:293786
ANK repeat 1517..1548 CDD:293786 8/27 (30%)
ANK repeat 1550..1581 CDD:293786 14/33 (42%)
ANK repeat 1617..1648 CDD:293786 9/23 (39%)
ANK repeat 1650..1682 CDD:293786
ANK repeat 1684..1715 CDD:293786
ANK repeat 1717..1742 CDD:293786
ANK repeat 1750..1775 CDD:293786
ANKRD66NP_001155907.3 ANKYR <6..>132 CDD:440430 41/123 (33%)
ANK 1 7..37 8/26 (31%)
ANK repeat 10..39 CDD:293786 8/28 (29%)
ANK repeat 43..74 CDD:293786 13/30 (43%)
ANK 2 43..72 13/28 (46%)
ANK repeat 76..107 CDD:293786 10/31 (32%)
ANK 3 76..105 9/29 (31%)
ANK repeat 109..138 CDD:293786 9/23 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..196
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.