DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10011 and ankrd50

DIOPT Version :9

Sequence 1:NP_651624.2 Gene:CG10011 / 43387 FlyBaseID:FBgn0039590 Length:2119 Species:Drosophila melanogaster
Sequence 2:NP_001108039.1 Gene:ankrd50 / 100136848 ZFINID:ZDB-GENE-111027-23 Length:246 Species:Danio rerio


Alignment Length:125 Identity:50/125 - (40%)
Similarity:68/125 - (54%) Gaps:16/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   718 CRT-IIADGYYELLLSNPEILECLSVDNIEKNPDECFKKAFLFPLLELTPPKTALLLLIDSIDEN 781
            ||: ::.|  ||..|..|.|...|.....|:||.|.||:..|.|||....|..|:.||:||:||.
Zfish   122 CRSGLVPD--YEEKLREPAIQSALQPGECERNPAETFKRCVLLPLLSCKAPSQAVFLLLDSVDEG 184

  Fly   782 YINEGNLISTLKGGRGTVTNHKSRNVAELLSNHIHLFPKWLFLVCTTKKQTKQITKMFTG 841
            .:         .|.|    :..|..:||||::|..|||.||.|:|:.::|.|.|||:|||
Zfish   185 CV---------FGDR----DQTSAGIAELLADHQKLFPAWLLLICSARRQNKHITKLFTG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10011NP_651624.2 AAA 344..457 CDD:214640
Methylase_S <772..885 CDD:279728 29/70 (41%)
Ank_4 1237..1291 CDD:290365
ANK 1266..1403 CDD:238125
ANK repeat 1270..1313 CDD:293786
Ank_2 1275..1380 CDD:289560
ANK repeat 1315..1347 CDD:293786
ANK repeat 1349..1380 CDD:293786
Ank_2 1354..1449 CDD:289560
ANK repeat 1382..1413 CDD:293786
ANK 1410..1538 CDD:238125
ANK repeat 1415..1446 CDD:293786
Ank_5 1438..1489 CDD:290568
ANK 1479..1604 CDD:238125
ANK repeat 1484..1515 CDD:293786
Ank_2 1489..1581 CDD:289560
ANK repeat 1517..1548 CDD:293786
ANK repeat 1550..1581 CDD:293786
Ank_2 1555..1648 CDD:289560
ANK 1578..1705 CDD:238125
ANK repeat 1617..1648 CDD:293786
Ank_2 1624..1715 CDD:289560
ANK 1645..1771 CDD:238125
ANK repeat 1650..1682 CDD:293786
ANK repeat 1684..1715 CDD:293786
Ank_2 1689..1781 CDD:289560
ANK repeat 1717..1742 CDD:293786
ANK repeat 1750..1775 CDD:293786
ankrd50NP_001108039.1 AAA_16 12..215 CDD:379062 40/107 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFJC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.