DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9986 and JUN

DIOPT Version :9

Sequence 1:NP_651623.1 Gene:CG9986 / 43386 FlyBaseID:FBgn0039589 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_002219.1 Gene:JUN / 3725 HGNCID:6204 Length:331 Species:Homo sapiens


Alignment Length:231 Identity:46/231 - (19%)
Similarity:82/231 - (35%) Gaps:83/231 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 NIRILSANVTELCSPLHAEESLNGLNMALGLYSSSLCGVVVLTPSIQAQANKNIIKNANKSTEFH 342
            |.:||..::|              ||:|..:.|        |.|.::|       ||::..|   
Human    30 NPKILKQSMT--------------LNLADPVGS--------LKPHLRA-------KNSDLLT--- 62

  Fly   343 FEQIDVQMEKI-EKQIKNLTTEDSSGSSTSNSSAEGSGTPSPTKKSVPRLKT------GDFFITK 400
              ..||.:.|: ..:::.|..:.|:|..|:        ||:||:...|:..|      .:.|:..
Human    63 --SPDVGLLKLASPELERLIIQSSNGHITT--------TPTPTQFLCPKNVTDEQEGFAEGFVRA 117

  Fly   401 HSNLSQTHVIFHLIS-DEPINS--------------------PSEINSRHPVILGLRNI----LK 440
            .:.|...:.:..:.| .:|:|.                    .:.::|..||...|.|.    |.
Human   118 LAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALS 182

  Fly   441 T---ASRHDITTLTIPALLR------HEMSEDMTVQ 467
            :   |..:....|..||..:      |.:.:.|.||
Human   183 SGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9986NP_651623.1 DUF2362 44..528 CDD:287163 46/231 (20%)
JUNNP_002219.1 Jun 5..241 CDD:309180 46/231 (20%)
Interaction with PAGE4. /evidence=ECO:0000269|PubMed:26242913 150..223 14/69 (20%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 252..279
bZIP_Jun 254..314 CDD:269844
coiled coil 255..306 CDD:269844
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 280..308
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.815465 Normalized mean entropy S81
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.