DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and NAM8

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:57/255 - (22%)
Similarity:102/255 - (40%) Gaps:53/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLFIGGLDYRTTDENL---------KAHFE---KWGNIVDVVVMKDPRTKRSRGFGFITYSHSSM 84
            :|::|.|| .|.|:|.         :|:..   .|.|.::.........|.::|:.|:.:..|:.
Yeast    55 QLYMGDLD-PTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCFVDFPSSTH 118

  Fly    85 IDEAQKSRPHKIDGRVVEPKRAVPRQDI----------DSPNAGATVK-----KLFVGALKDDHD 134
            ...|...     :|.:: |.  .|.:.:          :|.|:...||     .:|||.|..:..
Yeast   119 AANALLK-----NGMLI-PN--FPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGDLAPNVT 175

  Fly   135 EQSIRDYF-QHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQ-LNGKMVDVKKA 197
            |..:.:.| ..:.:.....||.|:.||..:|:.||:|.:.|.....:.:.|.. |||:.:   |.
Yeast   176 ESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAI---KV 237

  Fly   198 LPKQNDQQGGGGGRGGPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNRGGNDNWG 257
            .|....||          ..:|.|..|....:..|:|....:.:.|.::.:|  ||:|.|
Yeast   238 GPTSGQQQ----------HVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSN--GNNNMG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 17/88 (19%)
RRM_SF 123..195 CDD:302621 20/73 (27%)
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023 18/97 (19%)
RRM2_SECp43_like 162..241 CDD:409781 22/81 (27%)
RRM3_NGR1_NAM8_like 312..383 CDD:409782
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.