DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and HRB1

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_014394.2 Gene:HRB1 / 855728 SGDID:S000004949 Length:454 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:53/231 - (22%)
Similarity:98/231 - (42%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSNQNQNGNSNGHDDDFP-----QDSITEPE----HMRKLFIGGLDYRTTDENLKAHFEKWGNIV 58
            :|.:...|:|....|..|     .||..|.:    :...:|:|.|.|.:|.|:|...|.:.|.:|
Yeast   124 DSRRGGFGSSGARGDYGPLLARELDSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVV 188

  Fly    59 --DVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATV 121
              |::..:.    ..||.|.:.:::|..:|.|.:    :.||.....::...|||...|:.....
Yeast   189 RADIITSRG----HHRGMGTVEFTNSDDVDRAIR----QYDGAFFMDRKIFVRQDNPPPSNNIKE 245

  Fly   122 KK-LFVGALKDD---HDE-----------QSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFD 171
            :| |..|.|:.:   |:.           |:::|.|:..||:...::.:|.: |...|...|.|.
Yeast   246 RKALDRGELRHNRKTHEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGD-GVSTGSGTVSFY 309

  Fly   172 DYDPVDKVVLQ-KQHQLNGKMVDVKKALPKQNDQQG 206
            |...:.:.:.: ..:.:.|.::|||......|...|
Yeast   310 DIKDLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 19/78 (24%)
RRM_SF 123..195 CDD:302621 18/87 (21%)
HRB1NP_014394.2 PRK12678 <29..>85 CDD:237171
RRM1_HRB1_GBP2 160..236 CDD:410184 21/83 (25%)
RRM2_HRB1_GBP2 262..334 CDD:410185 13/72 (18%)
RRM3_HRB1_GBP2 374..452 CDD:410186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.