DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and CP31B

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:219 Identity:65/219 - (29%)
Similarity:99/219 - (45%) Gaps:28/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VNSNQNQNGNSNGHDDDFPQDSIT--------------EPEHMRKLFIGGLDYRTTDENLKAHFE 52
            |:...|......|.|......|:|              ||....|||:|.|.|....:.|...||
plant    70 VSQTSNWAEEEEGEDGSIGGTSVTVDESFESEDGVGFPEPPEEAKLFVGNLPYDVDSQALAMLFE 134

  Fly    53 KWG--NIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS----RPHKIDGRVVEPKRAVPR-- 109
            :.|  .|.:|:..:|  |.:||||||:|   .|.::||:|:    ...:::||.:...||.||  
plant   135 QAGTVEISEVIYNRD--TDQSRGFGFVT---MSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGS 194

  Fly   110 QDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYD 174
            :....|.......:::||.|..|.|...:...|...|.:||..:|.|:|||:.|||.||:..:.:
plant   195 RPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNEN 259

  Fly   175 PVDKVVLQKQHQ-LNGKMVDVKKA 197
            .|:..:.....| |.|:.:.|..|
plant   260 EVNVAIAALDGQNLEGRAIKVNVA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 29/82 (35%)
RRM_SF 123..195 CDD:302621 23/72 (32%)
CP31BNP_199836.1 RRM_SF 114..193 CDD:418427 30/83 (36%)
RRM2_NsCP33_like 208..283 CDD:410187 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.