DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and AT5G40490

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_198865.1 Gene:AT5G40490 / 834047 AraportID:AT5G40490 Length:423 Species:Arabidopsis thaliana


Alignment Length:408 Identity:141/408 - (34%)
Similarity:190/408 - (46%) Gaps:83/408 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DDDFPQDSITEP------EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGF 74
            :||   |..::|      :...|:|:|||...||......||.|:|.|.|.|:|||.:|.:.|||
plant    24 EDD---DDKSQPHSGGGVDSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGF 85

  Fly    75 GFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIR 139
            ||:||:.||::|:..:.. |.|.|:.||.||.:||..:.|.:  ...||:|||.:....|:...:
plant    86 GFVTYADSSVVDKVIQDN-HIIIGKQVEIKRTIPRGSMSSND--FKTKKIFVGGIPSSVDDDEFK 147

  Fly   140 DYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ-KQHQLNGKMVDVKKALPKQ-- 201
            ::|..||.:.:..|:.|..||:.|||.||.::..|.||.::.: .:.:|:|..|::|||.||:  
plant   148 EFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPKKPN 212

  Fly   202 --------------------NDQQGGG-----GGRGGP----GGRAGGNRGNMG--GGNYGNQNG 235
                                .|..|||     ||.|||    ||..||..|..|  ||.:|...|
plant   213 SVTTPSKRFGDSRSNFGGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGG 277

  Fly   236 GG----------------NWNNGGNNWGNNRGGNDNWGNNSFGGGGGG---------GGGYGGGN 275
            ||                :...||...|.||||....|...:|||.|.         ||||||.:
plant   278 GGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPS 342

  Fly   276 NSWGN--NNPWDNGNGGGNFGGGGNNWNNGGN-DFGGYQQNYGGGPQRGGGNFNNNRMQPYQGGG 337
            .|:|.  .:....|.|||..|.||..:..||. |.||......||...|||.         .|||
plant   343 GSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGG---------NGGG 398

  Fly   338 GFKAGGGNQGNYGGNNQG 355
            .|..|||.:|.|||...|
plant   399 SFYGGGGGRGGYGGGGSG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 35/76 (46%)
RRM_SF 123..195 CDD:302621 23/72 (32%)
AT5G40490NP_198865.1 RRM_SF 44..114 CDD:302621 32/70 (46%)
RRM_SF 131..206 CDD:302621 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I1071
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.