DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and AT5G06210

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_196239.1 Gene:AT5G06210 / 830508 AraportID:AT5G06210 Length:146 Species:Arabidopsis thaliana


Alignment Length:97 Identity:36/97 - (37%)
Similarity:52/97 - (53%) Gaps:7/97 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ-KQHQ 186
            |||:|.|.....||.:.:.|...|.:|:..||:|:.:.:.:||.||.|...|...|.::: ...|
plant    35 KLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQ 99

  Fly   187 LNGKMVDVKKALPKQNDQQGGGGG----RGGP 214
            |||:.:.|..|..||:  .|||||    ||.|
plant   100 LNGRTIFVDYAKAKQS--LGGGGGYPIARGPP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022
RRM_SF 123..195 CDD:302621 24/72 (33%)
AT5G06210NP_196239.1 RRM_SF 34..113 CDD:418427 26/77 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.