DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and RBP31

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001328008.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:187 Identity:59/187 - (31%)
Similarity:93/187 - (49%) Gaps:15/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHS 82
            :||     ||....|||:|.|.|....:.|...||:.|.:....|:.:..|.:||||||:|   .
plant   142 EFP-----EPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVT---M 198

  Fly    83 SMIDEA----QKSRPHKIDGRVVEPKRAVPR--QDIDSPNAGATVKKLFVGALKDDHDEQSIRDY 141
            |.:|||    :|...:.::||::...:|.||  :...:|.......:::||.|..|.|...:...
plant   199 SSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQL 263

  Fly   142 FQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQ-LNGKMVDVKKA 197
            |...|.:|:..:|.|:|||:.|||.||...|.|.:::.:.....| |.|:.:.|..|
plant   264 FSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 27/80 (34%)
RRM_SF 123..195 CDD:302621 23/72 (32%)
RBP31NP_001328008.1 RRM_HP0827_like 151..228 CDD:240845 27/79 (34%)
RRM_HP0827_like 245..321 CDD:240845 25/76 (33%)
DNA_pol_phi <87..145 CDD:368199 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.