DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and ARP1

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_191037.1 Gene:ARP1 / 824642 AraportID:AT3G54770 Length:261 Species:Arabidopsis thaliana


Alignment Length:123 Identity:35/123 - (28%)
Similarity:59/123 - (47%) Gaps:23/123 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKD 65
            |..||     |.||...|         ..:.|:|:|||.:.|..|.:..||.|:|:|::.|::.|
plant     1 MTTSN-----NVNGCFGD---------TKLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISD 51

  Fly    66 PRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKK 123
            ..|:||:|:||:|:..:.....|.:.....|:||         |.:.:..:.|..::|
plant    52 KLTRRSKGYGFVTFKDAKAATRACEDSTPIINGR---------RANCNLASLGGRLRK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 25/76 (33%)
RRM_SF 123..195 CDD:302621 1/1 (100%)
ARP1NP_191037.1 RRM <17..>121 CDD:223796 28/93 (30%)
RRM_RBM24_RBM38_like 17..92 CDD:240830 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.