DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and CP33

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:224 Identity:59/224 - (26%)
Similarity:97/224 - (43%) Gaps:62/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DDFPQDSITEPEHMR------------------------KLFIGGLDYRTTDENLKAHFEKWGNI 57
            ||..|.|:.|.|.:.                        :|::|.|.|..|...|...|.:.|.:
plant    78 DDEIQASVEEEEEVEEEGDEGEEEVEEEKQTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTV 142

  Fly    58 VDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS----RPHKIDGRVVE---PKRAVPR------ 109
            |||.::.|..|.|||||||:|   ...|:||:::    ...:|.||.|:   |:  |||      
plant   143 VDVQIVYDKVTDRSRGFGFVT---MGSIEEAKEAMQMFNSSQIGGRTVKVNFPE--VPRGGENEV 202

  Fly   110 -----QD-----IDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRG 164
                 :|     :|||:      |::.|.|..:...|.::|.|.....::...::.::.||:.||
plant   203 MRTKIRDNNRSYVDSPH------KVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRG 261

  Fly   165 FAFVEFDDYDPVDKVVLQKQHQLNGKMVD 193
            |.|:.|:..:.|...:.    .:||..|:
plant   262 FGFISFESAENVQSALA----TMNGVEVE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 30/83 (36%)
RRM_SF 123..195 CDD:302621 17/71 (24%)
CP33NP_190806.1 RRM_HP0827_like 117..193 CDD:240845 28/78 (36%)
RRM_SF 220..295 CDD:302621 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.