DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and AT2G37220

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:189 Identity:55/189 - (29%)
Similarity:90/189 - (47%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMID-EAQKSRPHK 95
            |||:|.|.:......|...||..||:..|.|:.|..|.|||||||:|.|..|.:: .||:...::
plant    92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYE 156

  Fly    96 IDGRVVE-------PKR-----AVPRQDIDSPNAG---------ATVKKLFVGALKDDHDEQSIR 139
            :|||.:.       |||     ..||....|..:|         .:..:::||.|....|:.::.
plant   157 LDGRPLRVNAGPPPPKREDGFSRGPRSSFGSSGSGYGGGGGSGAGSGNRVYVGNLSWGVDDMALE 221

  Fly   140 DYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQ-HQLNGKMVDVKKA 197
            ..|...|.:|:..::.|:::|:.:||.||.:|....|...:.... ..|:|:.:.|.:|
plant   222 SLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 32/89 (36%)
RRM_SF 123..195 CDD:302621 17/72 (24%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:418427 29/77 (38%)
RRM2_NsCP33_like 205..280 CDD:410187 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.