DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and AT2G35410

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:216 Identity:54/216 - (25%)
Similarity:94/216 - (43%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DDDFPQDSITEPEH----MRKLFIGGLDYRTTDENLKAHFEKWG--NIVDVVVMKDPRTKRSRGF 74
            |::..|:..||...    .||||:..|.:..:..::...|.:.|  |.|:::..||   .::|||
plant    76 DEETSQEEKTEETQNSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKD---GKNRGF 137

  Fly    75 GFITYSHSSMIDEAQ----KSRPHKIDGRVVEP------KRAVPR--QDIDSPNAGATVKKLFVG 127
            .|:|.:..   :|||    |....::.||::..      |:..|:  .|:.||..|.|..||:|.
plant   138 AFVTMASG---EEAQAAIDKFDTFQVSGRIISVSFARRFKKPTPKSPNDLPSPAPGDTRHKLYVS 199

  Fly   128 ALKDDHDEQSIRDYFQHFG-NIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGK- 190
            .|........:|:.|.... |.|...:|.....|:..|:.||.|...:..:..:.    :|||| 
plant   200 NLAWKARSTHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATREEAENAIT----KLNGKE 260

  Fly   191 ----MVDVKKALPKQNDQQGG 207
                .:.:|.:|...::.:.|
plant   261 IMGRPITLKFSLRSASESEDG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 22/88 (25%)
RRM_SF 123..195 CDD:302621 18/77 (23%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 47/191 (25%)
RRM_SF 97..168 CDD:409669 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.