DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and AT2G19380

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_565450.1 Gene:AT2G19380 / 816456 AraportID:AT2G19380 Length:613 Species:Arabidopsis thaliana


Alignment Length:276 Identity:60/276 - (21%)
Similarity:89/276 - (32%) Gaps:101/276 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHK 95
            |.:|:.|..:.||.||||..||.:|.|.:..|:.|..|.|.:|:||:.:.......||.|....:
plant   408 RNIFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKR 472

  Fly    96 IDGRVV-------EPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINI 153
            :..|:|       :|.:|...||:..|                                   :||
plant   473 MYNRIVVCNLASEKPGKAGKEQDMAEP-----------------------------------VNI 502

  Fly   154 VIDKETGKK----------RGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDV-KKALPKQNDQQGG 207
            .:.|...:.          ||.              ||:|.|....:.:|: .:.:|..      
plant   503 DLTKMANQSEAVLPGIELGRGH--------------VLEKMHHQQQQTMDMFGQNMPFY------ 547

  Fly   208 GGGRGGPG-----GRAGGNRGNMGGGNYGNQNGGGNWNNGG-----NNWGNNRGGNDNWGNNSFG 262
            |.....||     |...||:...|..|||....|...|.|.     |:.|.              
plant   548 GYSHQFPGFDPMYGALSGNQMLAGLPNYGMFGSGMMTNQGSMLPPPNHLGM-------------- 598

  Fly   263 GGGGGGGGYGGGNNSW 278
                .|..:|.|..:|
plant   599 ----AGQYFGDGEQAW 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 26/83 (31%)
RRM_SF 123..195 CDD:302621 10/82 (12%)
AT2G19380NP_565450.1 zf-LYAR 30..57 CDD:285943
ZnF_U1 83..116 CDD:197732
ZnF_U1 151..185 CDD:197732
ZnF_U1 221..255 CDD:197732
RRM_SF 408..483 CDD:302621 25/74 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.