DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and SRSF2

DIOPT Version :10

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_003007.2 Gene:SRSF2 / 6427 HGNCID:10783 Length:221 Species:Homo sapiens


Alignment Length:75 Identity:26/75 - (34%)
Similarity:42/75 - (56%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSR 92
            |.|..|.:..|.|||:.:.|:..|||:|.:.||.:.:|..||.||||.|:.:......::|..: 
Human    11 EGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDA- 74

  Fly    93 PHKIDGRVVE 102
               :||.|::
Human    75 ---MDGAVLD 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:409992 24/71 (34%)
RRM_SF 123..195 CDD:473069
SRSF2NP_003007.2 RRM_SRSF2_SRSF8 16..88 CDD:409751 24/70 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.