DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and RBM3

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens


Alignment Length:159 Identity:56/159 - (35%)
Similarity:77/159 - (48%) Gaps:21/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQ--- 184
            |||||.|..:.|||::.|:|..||.|.::.:|.|:||.:.|||.|:.|.  :|....|..:.   
Human     7 KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFT--NPEHASVAMRAMNG 69

  Fly   185 HQLNGKMVDVKKALPKQNDQQGGGGGRGGPG---GRAGGNRGNMGGGNYGNQNGGGNWNNGGNNW 246
            ..|:|:.:.|..|.......:|||.|..|.|   .|.||::| .|.|.|.:...||.    |..:
Human    70 ESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQG-YGSGRYYDSRPGGY----GYGY 129

  Fly   247 GNNRGGNDNWGNNSFGGGGGGGGGYGGGN 275
            |.:|..|   |.|.     ||...|.|||
Human   130 GRSRDYN---GRNQ-----GGYDRYSGGN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022
RRM_SF 123..195 CDD:302621 27/74 (36%)
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 29/79 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 28/83 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.