DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and zcrb1

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001017589.2 Gene:zcrb1 / 550251 ZFINID:ZDB-GENE-041210-114 Length:218 Species:Danio rerio


Alignment Length:92 Identity:21/92 - (22%)
Similarity:45/92 - (48%) Gaps:6/92 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHK-I 96
            :::..:.:..|:.::.....|:|.:|.|.::||..|:.|:|..|:.:..........:|..:| :
Zfish    12 VYVSNIPFSLTNSDMHKLCSKYGKVVKVTIVKDKHTRMSKGVAFVLFLDRESAYNCSRSLNNKQL 76

  Fly    97 DGRVVEPKRAVPRQDIDSPNAGATVKK 123
            .||:|:...|     ||:..|...::|
Zfish    77 FGRMVKASIA-----IDNGRAAEFIRK 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 17/76 (22%)
RRM_SF 123..195 CDD:302621 1/1 (100%)
zcrb1NP_001017589.2 RRM <7..>106 CDD:223796 21/92 (23%)
RRM_ZCRB1 9..86 CDD:240839 16/73 (22%)
zf-CCHC 106..122 CDD:278525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.