DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and CG5213

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:145 Identity:43/145 - (29%)
Similarity:69/145 - (47%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRP-HKI 96
            |.:..|....|:..|...|.|:|.|....:::..||..|..:||:.|     :.|.|.:.. :.:
  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDY-----VSERQAAAAVNGM 102

  Fly    97 DGRVVEPKR-----AVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVID 156
            ||.....||     |.|.:      ..:|...|:||.|....||:.:|:.|..:|||||:|::..
  Fly   103 DGYETRGKRLKVAFA
RPSE------YESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRH 161

  Fly   157 KETGKKRGFAFVEFD 171
            |...:.||.||::|:
  Fly   162 KFNNRSRGVAFLQFE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 21/81 (26%)
RRM_SF 123..195 CDD:302621 20/49 (41%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/78 (26%)
RRM 128..202 CDD:214636 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.