DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and CG2931

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:131 Identity:35/131 - (26%)
Similarity:57/131 - (43%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EAQKSRPHKIDGRVVEPKRA---------VPRQDIDSPN---AGATV-------------KKLFV 126
            :|:||.|:.|....::..||         ..|:..|...   ||.||             .::|.
  Fly   138 KAEKSGPNPIAEEAIKAARASSALQSFQTTERKKKDRKTVRIAGGTVWEDTSLADWPDDDFRIFC 202

  Fly   127 GALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKM 191
            |.|.:|.:::.:...|..|.:.....:|.||.|||.:||.||.|  .:|.|.:...|  :::|:.
  Fly   203 GDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSF--REPADFIRAMK--EMDGRY 263

  Fly   192 V 192
            |
  Fly   264 V 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 7/30 (23%)
RRM_SF 123..195 CDD:302621 22/70 (31%)
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 22/77 (29%)
RRM <194..>280 CDD:223796 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.