DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and Rbp6

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster


Alignment Length:175 Identity:75/175 - (42%)
Similarity:111/175 - (63%) Gaps:2/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91
            |....|:|||||.::|:.|:|:.:|.::|:|.:.:|||||.|:|||||||:|:|..:.:|:....
  Fly    25 PNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQ 89

  Fly    92 RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVID 156
            ..|::||:.|:||.|.||:  ..|......||:|||.|......:.::.||:.||.|.|..::.|
  Fly    90 GTHELDGKKVDPKVAFPRR--AHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFD 152

  Fly   157 KETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ 201
            |:|.:.|||.||.|...|.||||.....|::|.|||:.|||.||:
  Fly   153 KQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 35/76 (46%)
RRM_SF 123..195 CDD:302621 30/71 (42%)
Rbp6NP_001097631.1 RRM1_MSI 31..105 CDD:241020 33/73 (45%)
RRM2_MSI 119..192 CDD:240769 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1542
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.