DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and tra2b

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_957491.1 Gene:tra2b / 394172 ZFINID:ZDB-GENE-040426-1094 Length:278 Species:Danio rerio


Alignment Length:194 Identity:41/194 - (21%)
Similarity:71/194 - (36%) Gaps:60/194 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIG--------------GLDYRTTDENLKAHFEK 53
            :|..::..:|:.|          .|...|:..||              ||...||:.:|:..|.|
Zfish    91 SSEYHRRRSSHSH----------SPMSNRRRHIGDRANPDPNCCLGVFGLSLYTTERDLREVFSK 145

  Fly    54 WGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA-QKSRPHKIDGRVVE--------PKRAVPR 109
            :|.:.||.::.|.:::|||||..:.:.:.....|| :::...::|||.:.        |....|.
Zfish   146 YGPLSDVCIVYDQQSRRSRGFALVYFENREDSKEAKERANGMELDGRRIRVDYSITKGPHTPTPG 210

  Fly   110 QDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDY 173
            ..:..|..|....   |...:|.:|.                        |.:||:...|..||
Zfish   211 IYMGRPTYGGGPS---VSRRRDSYDR------------------------GYERGYDSYEDRDY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 24/99 (24%)
RRM_SF 123..195 CDD:302621 9/51 (18%)
tra2bNP_957491.1 RRM_TRA2B 114..202 CDD:241085 22/87 (25%)
RRM <118..>199 CDD:223796 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.