DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and CG3335

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:176 Identity:55/176 - (31%)
Similarity:86/176 - (48%) Gaps:25/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMK-----DPRTKRSRGFG 75
            :|...:|:..|||....||:..|:::|..|.::.||...|:|..|.:.|     :||..:|.|:|
  Fly   664 EDSRAEDADDEPEPNTTLFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYG 728

  Fly    76 FITYSHSSMIDEAQKS-RPHKIDGRVVEPKRA---VPRQDIDSPNAGA----------TVKKLFV 126
            ||.:..||:.:.|.|: :...|||..||.||:   :..||    |.||          |..|:.|
  Fly   729 FIQFKKSSVAEHALKNLQLTHIDGNPVELKRSDRVLKTQD----NDGAQRRLASQKKQTGTKILV 789

  Fly   127 GALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGK--KRGFAFVEF 170
            ..:......:.:||.|:.||.:..:.|.....||:  .|||.||::
  Fly   790 RNIPFQAQYREVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDY 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 29/85 (34%)
RRM_SF 123..195 CDD:302621 15/50 (30%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 55/176 (31%)
RRM5_RBM19_like 679..760 CDD:240764 28/80 (35%)
RRM6_RBM19 785..864 CDD:241015 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.