powered by:
Protein Alignment Hrb98DE and Slirp
DIOPT Version :9
Sequence 1: | NP_524543.1 |
Gene: | Hrb98DE / 43385 |
FlyBaseID: | FBgn0001215 |
Length: | 365 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_081234.2 |
Gene: | Slirp / 380773 |
MGIID: | 1916394 |
Length: | 112 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 36/65 - (55%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 IRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVK----KAL 198
:|::|..||::....:..|||||..||..:|:|...:.:...:.|:.|.::|..:.|: |||
Mouse 35 LREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQNALQQEHHIIDGVKIHVQAQRAKAL 99
Fly 199 198
Mouse 100 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.