DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and SLIRP1

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:80 Identity:27/80 - (33%)
Similarity:49/80 - (61%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 182
            |.:|.::|||.|......|.:|.||:.||.:|..|::.||.||..:|:.||.|:....::|:..:
  Fly    11 GKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENE 75

  Fly   183 KQHQLNGKMVDVKKA 197
            ::|.|.|..::::|:
  Fly    76 QKHILEGNYLNIQKS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022
RRM_SF 123..195 CDD:302621 24/71 (34%)
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.