DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and Zcrb1

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001030112.1 Gene:Zcrb1 / 362990 RGDID:1309851 Length:217 Species:Rattus norvegicus


Alignment Length:143 Identity:32/143 - (22%)
Similarity:62/143 - (43%) Gaps:32/143 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITY-SHSSMIDEAQKSRPHKI 96
            :::..|.:..|:.:|...|.|:|.:|.|.:|||..|::|:|..||.: ...|.::..:.....::
  Rat    12 VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSALNCTRAINNKQL 76

  Fly    97 DGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ-----------HFGNIVD 150
            .|||::...|     ||:..|...:::               |:||.           |......
  Rat    77 FGRVIKAS
IA-----IDNGRAAEFIRR---------------RNYFDKSKCYECGESGHLSYACP 121

  Fly   151 INIVIDKETGKKR 163
            .|::.::|..||:
  Rat   122 KNMLGEREPPKKK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 21/76 (28%)
RRM_SF 123..195 CDD:302621 8/52 (15%)
Zcrb1NP_001030112.1 RRM_ZCRB1 9..84 CDD:409827 20/71 (28%)
PTZ00368 <97..123 CDD:173561 4/40 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.