DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and Rbm34

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001014037.1 Gene:Rbm34 / 307956 RGDID:1310161 Length:428 Species:Rattus norvegicus


Alignment Length:149 Identity:40/149 - (26%)
Similarity:72/149 - (48%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDE 87
            |.|.....|.:|:|.|.||..:..|:.||...|:||.|.::::|.|...||||::.:.::..:..
  Rat   277 SETASRDKRSVFVGNLPYRVDESALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFENTDAVHL 341

  Fly    88 AQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYF------QHFG 146
            |.|....::.||.:...|:|.::.:...|:..:|||        |..:...|..|      .|..
  Rat   342 ALKLNNSELMGRKLRVMRSVNKEKLKQQNSNPSVKK--------DGSKSKQRLNFTSKEGKSHSK 398

  Fly   147 N--IVDINIVIDKETGKKR 163
            |  |.:..:::.|:.|:|:
  Rat   399 NAFIGEKAVLMKKKKGQKK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 24/76 (32%)
RRM_SF 123..195 CDD:302621 10/49 (20%)
Rbm34NP_001014037.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..106
RRM 73..364 CDD:223796 27/86 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152
RRM1_RBM34 183..274 CDD:240840
RRM2_RBM34 286..358 CDD:240841 22/71 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..428 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.