DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and AT5G59865

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001331799.1 Gene:AT5G59865 / 28721278 AraportID:AT5G59865 Length:113 Species:Arabidopsis thaliana


Alignment Length:101 Identity:33/101 - (32%)
Similarity:57/101 - (56%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DSITEPEHMR---------KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFI 77
            :|||.|  :|         |||:|||.|.|.:..||..|||:|.|::|.|:.|.::.:|:|:||:
plant    10 NSITSP--LRCFAIRGSCSKLFVGGLSYDTNEPVLKNEFEKYGEIIEVKVICDHKSGKSKGYGFV 72

  Fly    78 TYSHSSMIDEAQKSRPHK-IDGRVVEPKRAVPRQDI 112
            .:........|..|..:: ::||.:..:.|.|::.:
plant    73 LFDSEEAAASALASMDNQLLEGRNIRVEYAQPKRSL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 27/77 (35%)
RRM_SF 123..195 CDD:302621
AT5G59865NP_001331799.1 RRM_SF 27..102 CDD:418427 26/74 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.