DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and RBM24

DIOPT Version :10

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001137414.1 Gene:RBM24 / 221662 HGNCID:21539 Length:236 Species:Homo sapiens


Alignment Length:68 Identity:30/68 - (44%)
Similarity:45/68 - (66%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKI 96
            |:|:|||.|.|||.:|:.:||.:|.|.:.||:.|.:|.:|||:||:|.:..:..:.|.|.....|
Human    12 KIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPII 76

  Fly    97 DGR 99
            |||
Human    77 DGR 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:409992 30/68 (44%)
RRM_SF 123..195 CDD:473069
RBM24NP_001137414.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 30/68 (44%)
Necessary for interaction with EIF4E. /evidence=ECO:0000269|PubMed:29358667 175..199
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.