DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and Rbm3

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001159881.1 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:157 Identity:52/157 - (33%)
Similarity:77/157 - (49%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPV-DKVVLQKQHQ 186
            |||||.|..:.|||::.|:|..||.|.::.:|.|:||.:.|||.|:.|.:.:.. |.:.......
Mouse     7 KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGES 71

  Fly   187 LNGKMVDVKKALPKQNDQQGGG-GGRGGPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNN--WGN 248
            |:|:.:.|..|.......:||. ||||....|.||::| .|.|.|.::.||..:..|.:.  .|.
Mouse    72 LDGRQIRVDHAGKSARGSRGGAFGGRGRSYSRGGGDQG-YGSGRYDSRPGGYGYGYGRSRDYSGR 135

  Fly   249 NRGGNDNWGNNSFGGGGGGGGGYGGGN 275
            ::||.|.               |.|||
Mouse   136 SQGGYDR---------------YSGGN 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022
RRM_SF 123..195 CDD:302621 26/72 (36%)
Rbm3NP_001159881.1 RRM_CIRBP_RBM3 6..85 CDD:240895 28/77 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.