DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and hrpa-2

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:207 Identity:71/207 - (34%)
Similarity:107/207 - (51%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKD 65
            |:...|........||         .|..:||||||||.:.||||.|..:|.:||.:||.:|::|
 Worm    49 MLRQFQQMGMGQYQHD---------SPPQLRKLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRD 104

  Fly    66 PRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDS----------PNAGAT 120
            |.||.||||||:|::.....:.|...||||:.|:.|:.|||:||:.:.|          |..|. 
 Worm   105 PNTKHSRGFGFVTFASIFSAESAMNDRPHKLGGKTVDSKRAIPREQMSSMIPPPFFETDPAPGC- 168

  Fly   121 VKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQK-- 183
             |.|..|.....|...|:|.||:.||.:..:.|:     |:.||..||.::|.:..|:.:...  
 Worm   169 -KLLLNGITNGVHSVDSLRVYFETFGTLDQVEIL-----GQPRGLGFVIYEDKESADRCLAHNSG 227

  Fly   184 QHQLNGKMVDVK 195
            :|.:|.:.::|:
 Worm   228 RHIVNERKIEVR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 39/76 (51%)
RRM_SF 123..195 CDD:302621 19/73 (26%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 66/183 (36%)
RRM1_hnRNPA_like 71..148 CDD:241022 39/76 (51%)
RRM_SF 183..240 CDD:302621 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5263
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.