Sequence 1: | NP_524543.1 | Gene: | Hrb98DE / 43385 | FlyBaseID: | FBgn0001215 | Length: | 365 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741783.1 | Gene: | hrpa-2 / 180791 | WormBaseID: | WBGene00019249 | Length: | 336 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 71/207 - (34%) |
---|---|---|---|
Similarity: | 107/207 - (51%) | Gaps: | 28/207 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKD 65
Fly 66 PRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDS----------PNAGAT 120
Fly 121 VKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQK-- 183
Fly 184 QHQLNGKMVDVK 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hrb98DE | NP_524543.1 | RRM1_hnRNPA_like | 32..109 | CDD:241022 | 39/76 (51%) |
RRM_SF | 123..195 | CDD:302621 | 19/73 (26%) | ||
hrpa-2 | NP_741783.1 | RRM | <62..230 | CDD:223796 | 66/183 (36%) |
RRM1_hnRNPA_like | 71..148 | CDD:241022 | 39/76 (51%) | ||
RRM_SF | 183..240 | CDD:302621 | 17/62 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 84 | 1.000 | Domainoid score | I5263 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |