DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb98DE and Tra2b

DIOPT Version :9

Sequence 1:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_476460.1 Gene:Tra2b / 117259 RGDID:619886 Length:288 Species:Rattus norvegicus


Alignment Length:215 Identity:54/215 - (25%)
Similarity:92/215 - (42%) Gaps:53/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RTKRSRGFG-----FITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNA--GATVKKL 124
            |..|||.:.     ..::|||.|...                :|.|..:....||.  |.....|
  Rat    79 RRSRSRSYSRDYRRRHSHSHSPMSTR----------------RRHVGNRANP
DPNCCLGVFGLSL 127

  Fly   125 FVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQH--QL 187
            :.       .|:.:|:.|..:|.|.|::||.|:::.:.||||||.|::.|.. |...::.:  :|
  Rat   128 YT-------TERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDA-KEAKERANGMEL 184

  Fly   188 NGKMVDVKKALPKQNDQQGGGGGRGGPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNRGG 252
            :|:.:.|..::.|:......|...|.|              .||:......::.     |.:||.
  Rat   185 DGRRIRVDFSITKRPHTPTPGIYMGRP--------------TYGSSRRRDYYDR-----GYDRGY 230

  Fly   253 ND-NWGNNSFGGGGGGGGGY 271
            :| ::.:.|:.||||||||:
  Rat   231 DDRDYYSRSYRGGGGGGGGW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 10/46 (22%)
RRM_SF 123..195 CDD:302621 21/73 (29%)
Tra2bNP_476460.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 10/50 (20%)
RRM_TRA2 117..196 CDD:409798 24/86 (28%)
Linker 193..230 8/55 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 6/47 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288 8/9 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.