DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FOXQ1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_150285.3 Gene:FOXQ1 / 94234 HGNCID:20951 Length:403 Species:Homo sapiens


Alignment Length:230 Identity:85/230 - (36%)
Similarity:119/230 - (51%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 MSASMNASMNGSMGAAAMNS--MGGNCMTPSSMSYASMGSPLGNMGGCMAMSAASMSAAGLSGTY 173
            :||:.:.|: ||.|..|.||  .||...........|.|...|......|.:||::.|.|...  
Human    32 LSAAGDDSL-GSDGDCAANSPAAGGGARDTQGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEA-- 93

  Fly   174 GAMPPGSREMETGSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQ 238
            ||..||:     |...| |.....||.|.|     .|||||||:||.|||:::....|||:||.:
Human    94 GAAGPGA-----GGAGS-GEGARSKPYTRR-----PKPPYSYIALIAMAIRDSAGGRLTLAEINE 147

  Fly   239 FIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKP-GKGSFWTLHPDSGNMFENGCYLRR 302
            ::|..|||:|.:...|:||:||:||.||||||:.|.|.:| ||.::|.|:|:|...|.:|.:.||
Human   148 YLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRR 212

  Fly   303 QKRFKDEKKEAIRQLHKSPSHSSLEATSPGKKDHE 337
            :||..          |::|      ..:||.:..|
Human   213 RKRLS----------HRAP------VPAPGLRPEE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 27/90 (30%)
FH 210..298 CDD:214627 45/88 (51%)
FOXQ1NP_150285.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 14/43 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 9/27 (33%)
FH 119..197 CDD:238016 41/77 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..266 5/32 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.