DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and FKH1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:68/223 - (30%)
Similarity:96/223 - (43%) Gaps:58/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TP--SSMSYASMGSPLGN--------------MGGCMAMSAASMSAAGLSGTYGAMPPGSREMET 185
            ||  ||.....:|.|.|:              .||....:..|.|...:  |.|.:|    .:|.
Yeast   232 TPLSSSSDVNPIGDPHGDTIMMEEDEEDENYTRGGIRPNTYTSSSNNAV--TNGNVP----HIEN 290

  Fly   186 GSPNSLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQN 250
            .|..||..:|            :.|||.||.|:||.||.:.|...::|::||:||.|.:.|||.:
Yeast   291 PSDLSLDENR------------YIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFS 343

  Fly   251 QQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIR 315
            |..||||:||:||.|..|.|:|:...:.|||..|.:..:....|.|        ::...|...||
Yeast   344 QMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLN--------KWNAGKLSKIR 400

  Fly   316 ---------QLHKS-------PSHSSLE 327
                     |||.|       |..||::
Yeast   401 RGASVTRQLQLHMSKFGEIPAPESSSID 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 19/87 (22%)
FH 210..298 CDD:214627 39/87 (45%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 68/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.