DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fkh and HCM1

DIOPT Version :9

Sequence 1:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster
Sequence 2:NP_009991.2 Gene:HCM1 / 850429 SGDID:S000000661 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:93/385 - (24%)
Similarity:154/385 - (40%) Gaps:88/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 SLGRSRVDKPTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRW 254
            ||.|.|::....       .||||||.:||.:||..:....||||:||.:|...||:|:|....|
Yeast    96 SLERRRINGELA-------KKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASW 153

  Fly   255 QNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHK 319
            ||||||:||.||.|:|..::.|  |||.||.:.|.:...|..|     :.|..:..|::::.:.|
Yeast   154 QNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRPGAETKFFKG-----ENRGYEFVKDSLQDIGK 211

  Fly   320 ----SPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEA 380
                ..:...||....|:.:.:            |...:..:|||               |....
Yeast   212 YFEIDSTLDELEQVESGEGNDD------------LPDEEEREEAG---------------KFPSI 249

  Fly   381 LAMLHANAELCLSQQPQHVP---THHH--HQHHQLQQEELSAMMANRCH-------PSLITDYHS 433
            ...|:::..|.:||. .|:|   |.:.  :.|..|  |.:..|:.|..:       |.::..||:
Yeast   250 EIQLNSSPILRVSQL-HHIPQLKTDNSVLNPHENL--ESMRNMIENDVNNIDSLEPPYVMKKYHT 311

  Fly   434 SM----------HPLKQEPSGYTPSSHPFSINRLLPTESKADIKMYDMSQYAGYNALSPLTNSHA 488
            |:          |......:.....::.|:...:...:|..:.:.|..|..:.:..||||.::  
Yeast   312 SLGLPSLVNAKDHFQAGVKNNNITQANRFNTLPITSAKSPQNFRKYFTSFNSNFEDLSPLRSN-- 374

  Fly   489 ALGQDSYYQSLGY--------------HAPAGTTSLXHHQY-PLAXGRAEQMLRSQQQQH 533
             :|..|....|.|              ..|....|..:.|. |........:|::.:.:|
Yeast   375 -VGAGSLLDPLPYSPLKLYDQKNLALMSKPQSQQSYSNSQLPPPPSSHGSDLLKTPKMRH 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 4/18 (22%)
FH 210..298 CDD:214627 42/87 (48%)
HCM1NP_009991.2 COG5025 20..564 CDD:227358 93/385 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I1601
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.